PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00017g00219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 270aa    MW: 29948.6 Da    PI: 10.035
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00017g00219.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.48.9e-1555101147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               r +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Peaxi162Scf00017g00219.1  55 RVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 101
                               789*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81150106IPR017930Myb domain
SuperFamilySSF466895.38E-1752106IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1753104IPR006447Myb domain, plants
SMARTSM007179.9E-1154104IPR001005SANT/Myb domain
PfamPF002496.0E-1255101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-1155101IPR009057Homeodomain-like
CDDcd001671.22E-957102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MSREESLSES VASGGTGAGG EIMLFGVRVK VDPMRKSVSL NNLSQYEQPN ANNSRVPWTE  60
EEHKLFLLGL QKVGKGDWRG ISRNFVKTRT PTQVASHAQK YFLRRTNLNR RRRRSSLFDI  120
TTDSVSVMPT EERKNLQDNH ISQVLAPTSL PSIETSKANP FQVETLPVTV RPFVLPAQIE  180
KPIESSIFGQ RDQTNNGSSI FWTVHADHPM SNSSRKADLN LNQSSAMEAA SSLSLTLSLS  240
LDQNQSASTR HSVFQVISNY CNGESIISVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1600955e-60AC160095.1 Solanum lycopersicum clone BB, complete sequence.
GenBankAC2095115e-60AC209511.1 Solanum lycopersicum chromosome 6 clone C06HBa0153G23, complete sequence.
GenBankAY7961145e-60AY796114.1 Lycopersicon esculentum clone Le_HBa 153G23 putative transposase, putative BAH domain-containing protein, putative permease I, putative pollen specific LIM domain-containing protein, putative betaine aldehyde dehyrogenase, EDS1, and putative ribosomal-protein S6 kinase-like protein genes, complete cds.
GenBankHG9754455e-60HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755185e-60HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599323.12e-90PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B08e-78MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLM1CA691e-81M1CA69_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000631724e-81(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.21e-43MYB_related family protein